-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAMA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LAMA4 (NP_001098678.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAMA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LAMA4 (NP_001098678.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05162A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAMA4 |
| Target Synonyms | LAMA3; CMD1JJ; LAMA4*-1; LAMA4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LAMA4 (NP_001098678.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQC | Uniprot ID | Q16363 |
Uniprot Id
Q16363
Target Species
Human
Target Name
LAMA4
Target Full Name
Laminin subunit alpha-4
Target Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Target Involvement
Cardiomyopathy, dilated 1JJ (CMD1JJ)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane. Note=Major component.
Target Tissue Specificity
In adult, strong expression in heart, lung, ovary small and large intestines, placenta, liver; weak or no expression in skeletal muscle, kidney, pancreas, testis, prostate, brain. High expression in fetal lung and kidney. Expression in fetal and newborn t
Target Synonyms
CMD1JJ; DKFZp686D23145 ; LAMA3 ; LAMA3, formerly; LAMA4 1; LAMA4; LAMA4*-1; LAMA4_HUMAN; Laminin alpha 4; Laminin alpha 4 chain; Laminin subunit alpha 4 precursor; Laminin subunit alpha-4; Laminin-14 subunit alpha; Laminin-8 subunit alpha; Laminin-9 subunit alpha
Target Background
Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the alpha chain isoform laminin, alpha 4. The domain structure of alpha 4 is similar to that of alpha 3, both of which resemble truncated versions of alpha 1 and alpha 2, in that approximately 1, 200 residues at the N-terminus (domains IV, V and VI) have been lost. Laminin, alpha 4 contains the C-terminal G domain which distinguishes all alpha chains from the beta and gamma chains. The RNA analysis from adult and fetal tissues revealed developmental regulation of expression, however, the exact function of laminin, alpha 4 is not known. Tissue-specific utilization of alternative polyA-signal has been described in literature. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification