Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lamin B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against Lamin B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-11708A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lamin B1 |
| Target Synonyms | LMN; ADLD; LMN2; LMNB; MCPH26; Lamin B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7, Mouse brain, Mouse spleen | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTS | Uniprot ID | P20700 |
Uniprot Id
P20700
Target Species
Human
Target Name
LMNB1
Target Full Name
Lamin-B1
Target Function
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin.
Target Involvement
Leukodystrophy, demyelinating, autosomal dominant, adult-onset (ADLD)
Target Subcellular Location
Nucleus inner membrane; Lipid-anchor; Nucleoplasmic side.
Target Protein Families
Intermediate filament family
Target Synonyms
ADLD; lamin B1; Lamin-B1; LMN; LMN2; LMNB; Lmnb1; LMNB1_HUMAN; MGC111419; OTTHUMP00000159218
Target Background
This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
