-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAMP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAMP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07725A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAMP1 |
| Target Synonyms | LAMPA; CD107a; LGP120; LAMP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT | Uniprot ID | P11279 |
Uniprot Id
P11279
Target Species
Human
Target Name
LAMP1
Target Full Name
Lysosome-associated membrane glycoprotein 1
Target Function
Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis. Plays also an important role in NK-cells cytotoxicity. Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.; (Microbial infection) Acts as a receptor for Lassa virus glycoprotein. Promotes also fusion of the virus with host membrane in less acidic endosomes.; (Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Cytolytic granule membrane; Single-pass type I membrane protein.
Target Protein Families
LAMP family
Target Synonyms
LAMP1; Lysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; CD107 antigen-like family member A; CD antigen CD107a
Target Background
The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.
Notification