Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAPTM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 153-262 of human LAPTM5 (NP_006753.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAPTM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 153-262 of human LAPTM5 (NP_006753.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11827A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAPTM5 |
| Target Synonyms | CLAST6; LAPTM5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Mouse spleen, Rat thymus, THP-1, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 153-262 of human LAPTM5 (NP_006753.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV | Uniprot ID | Q13571 |
Uniprot Id
Q13571
Target Species
Human
Target Name
LAPTM5
Target Full Name
Lysosomal-associated transmembrane protein 5
Target Function
May have a special functional role during embryogenesis and in adult hematopoietic cells.
Target Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Target Protein Families
LAPTM4/LAPTM5 transporter family
Target Tissue Specificity
Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney.
Target Synonyms
LAPTM5; KIAA0085; Lysosomal-associated transmembrane protein 5; Lysosomal-associated multitransmembrane protein 5; Retinoic acid-inducible E3 protein
Target Background
This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
