-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAT1/SLC7A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LAT1/SLC7A5 (NP_003477.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LAT1/SLC7A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LAT1/SLC7A5 (NP_003477.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12002A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAT1/SLC7A5 |
| Target Synonyms | E16; CD98; LAT1; 4F2LC; MPE16; D16S469E; LAT1/SLC7A5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LAT1/SLC7A5 (NP_003477.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYG | Uniprot ID | Q01650 |
Uniprot Id
Q01650
Target Species
Human
Target Name
SLC7A5
Target Full Name
Large neutral amino acids transporter small subunit 1
Target Function
The heterodimer with SLC3A2 functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan. Functions as an amino acid exchanger. May play a role in the transport of L-DOPA across the blood-brain barrier. May act as the major transporter of tyrosine in fibroblasts (Probable). May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier. Can mediate the transport of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane. When associated with LAPTM4B, the heterodimer formed by SLC3A2 and SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. Involved in the uptake of toxic methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the membrane.; (Microbial infection) In case of hepatitis C virus/HCV infection, the complex formed by SLC3A2 and SLC7A5/LAT1 plays a role in HCV propagation by facilitating viral entry into host cell and increasing L-leucine uptake-mediated mTORC1 signaling activation, thereby contributing to HCV-mediated pathogenesis.
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Target Protein Families
Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family
Target Tissue Specificity
Detected in placenta, in the syncytiotrophoblast layer (at protein level). Expressed abundantly in adult lung, liver, brain, skeletal muscle, placenta, bone marrow, testis, resting lymphocytes and monocytes, and in fetal liver. Weaker expression in thymus
Target Research Area
Transport, Signal Transduction
Target Synonyms
4F2 LC; 4F2 light chain; 4F2LC; CD98; CD98 light chain; CD98LC; D16S469E; DC49; E16; hLAT1; Integral membrane protein E16; L type amino acid transporter ; L type amino acid transporter 1; L-type amino acid transporter 1; Large neutral amino acids transporter 1; Large neutral amino acids transporter; Large neutral amino acids transporter small subunit 1; LAT1; LAT1_HUMAN; Membrane protein E16; MPE16; Slc7a5; Sodium independent neutral amino acid transporter; Sodium independent neutral amino acid transporter LAT1; Solute carrier family 7 (cationic amino acid transporter y+ system) member 5; Solute carrier family 7 member 5; TA1; Tumor associated protein 1; y+ system cationic amino acid transporter
Target Background
Enables L-leucine transmembrane transporter activity; L-tryptophan transmembrane transporter activity; and thyroid hormone transmembrane transporter activity. Involved in carboxylic acid transport; thyroid hormone transport; and xenobiotic transport. Located in cytosol; intracellular membrane-bounded organelle; and plasma membrane. Is integral component of membrane. Part of amino acid transport complex; apical plasma membrane; and microvillus membrane.
Notification