-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LBP (NP_004130.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LBP (NP_004130.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06903A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lbp |
| Target Synonyms | BPIFD2; LBP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, human serum, Mouse ovary, Mouse uterus, Rat kidney, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LBP (NP_004130.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLN | Uniprot ID | P18428 |
Uniprot Id
P18428
Target Species
Human
Target Name
LBP
Target Full Name
Lipopolysaccharide-binding protein
Target Function
Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Acts as an affinity enhancer for CD14, facilitating its association with LPS. Promotes the release of cytokines in response to bacterial lipopolysaccharide.
Target Subcellular Location
Secreted. Cytoplasmic granule membrane.
Target Protein Families
BPI/LBP/Plunc superfamily, BPI/LBP family
Target Tissue Specificity
Detected in blood serum (at protein level).
Target Research Area
Immunology
Target Synonyms
BPI fold containing family D, member 2; Bpifd2; LBP; LBP_HUMAN; LBP1; Lipopolysaccharide binding protein; Lipopolysaccharide-binding protein; LPS binding protein; Ly88; MGC22233; OTTHUMP00000030965; RP23-407H16.4
Target Background
The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP).
Notification