-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LCAT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LCAT (P04180) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LCAT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LCAT (P04180) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14383A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LCAT |
| Target Synonyms | LCAT; lecithin-cholesterol acyltransferase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse plasma, Rat plasma | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LCAT (P04180). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWI | Uniprot ID | P04180 |
Uniprot Id
P04180
Target Species
Human
Target Name
LCAT
Target Full Name
Phosphatidylcholine-sterol acyltransferase
Target Function
Central enzyme in the extracellular metabolism of plasma lipoproteins. Synthesized mainly in the liver and secreted into plasma where it converts cholesterol and phosphatidylcholines (lecithins) to cholesteryl esters and lysophosphatidylcholines on the surface of high and low density lipoproteins (HDLs and LDLs). The cholesterol ester is then transported back to the liver. Has a preference for plasma 16:0-18:2 or 18:O-18:2 phosphatidylcholines. Also produced in the brain by primary astrocytes, and esterifies free cholesterol on nascent APOE-containing lipoproteins secreted from glia and influences cerebral spinal fluid (CSF) APOE- and APOA1 levels. Together with APOE and the cholesterol transporter ABCA1, plays a key role in the maturation of glial-derived, nascent lipoproteins. Required for remodeling high-density lipoprotein particles into their spherical forms. Catalyzes the hydrolysis of 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (platelet-activating factor or PAF) to 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF). Also catalyzes the transfer of the acetate group from PAF to 1-hexadecanoyl-sn-glycero-3-phosphocholine forming lyso-PAF. Catalyzes the esterification of (24S)-hydroxycholesterol (24(S)OH-C), also known as cerebrosterol to produce 24(S)OH-C monoesters.
Target Involvement
Lecithin-cholesterol acyltransferase deficiency (LCATD); Fish-eye disease (FED)
Target Subcellular Location
Secreted.
Target Protein Families
AB hydrolase superfamily, Lipase family
Target Tissue Specificity
Detected in blood plasma. Detected in cerebral spinal fluid (at protein level). Detected in liver. Expressed mainly in brain, liver and testes.
Target Research Area
Metabolism
Target Synonyms
LCAT; LCAT_HUMAN; Lecithin cholesterol acyltransferase ; Lecithin-cholesterol acyltransferase; Phosphatidylcholine sterol acyltransferase; Phosphatidylcholine-sterol acyltransferase; Phospholipid cholesterol acyltransferase; Phospholipid-cholesterol acyltransferase
Target Background
This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
Notification