-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LDHB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LDHB (P07195) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against LDHB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LDHB (P07195) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-16100A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LDHB |
| Target Synonyms | LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281; LDHB | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LDHB (P07195). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVR | Uniprot ID | P07195 |
Uniprot Id
P07195
Target Species
Human
Target Name
LDHB
Target Full Name
L-lactate dehydrogenase B chain
Target Involvement
Lactate dehydrogenase B deficiency (LDHBD)
Target Subcellular Location
Cytoplasm. Mitochondrion inner membrane; Peripheral membrane protein.
Target Protein Families
LDH/MDH superfamily, LDH family
Target Research Area
Metabolism
Target Synonyms
Epididymis secretory protein Li 281; HEL S 281; L lactate dehydrogenase B chain; L-lactate dehydrogenase B chain; Lactate Dehydrogenase B; Lactate dehydrogenase H chain; LDH B ; LDH H; LDH heart subunit; LDH-B; LDH-H; LDHB; LDHB_HUMAN; LDHBD; LDHH; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-46; TRG-5; TRG5
Target Background
This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.
Notification