-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Leptin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Leptin Receptor (P48357) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Leptin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Leptin Receptor (P48357) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16546A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Leptin Receptor |
| Target Synonyms | OBR; OB-R; CD295; LEP-R; LEPRD; Leptin Receptor | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Hep G2, Mouse lung, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Leptin Receptor (P48357). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEQGLINSSVTKCFSSKNSPLKDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDKKSIYYLGVTSIKKRESGVLLTDKSRV | Uniprot ID | P48357 |
Uniprot Id
P48357
Target Species
Human
Target Name
LEPR
Target Full Name
Leptin receptor
Target Function
Receptor for hormone LEP/leptin (Probable). On ligand binding, mediates LEP central and peripheral effects through the activation of different signaling pathways such as JAK2/STAT3 and MAPK cascade/FOS. In the hypothalamus, LEP acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic and affects innate and adaptive immunity. Control of energy homeostasis and melanocortin production (stimulation of POMC and full repression of AgRP transcription) is mediated by STAT3 signaling, whereas distinct signals regulate NPY and the control of fertility, growth and glucose homeostasis. Involved in the regulation of counter-regulatory response to hypoglycemia by inhibiting neurons of the parabrachial nucleus. Has a specific effect on T lymphocyte responses, differentially regulating the proliferation of naive and memory T -ells. Leptin increases Th1 and suppresses Th2 cytokine production.; May transport LEP across the blood-brain barrier. Binds LEP and mediates LEP endocytosis. Does not induce phosphorylation of and activate STAT3.; Antagonizes Isoform A and isoform B-mediated LEP binding and endocytosis.
Target Involvement
Leptin receptor deficiency (LEPRD)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane.; [Isoform E]: Secreted.
Target Protein Families
Type I cytokine receptor family, Type 2 subfamily
Target Tissue Specificity
Isoform A is expressed in fetal liver and in hematopoietic tissues and choroid plexus. In adults highest expression in heart, liver, small intestine, prostate and ovary. Low level in lung and kidney. Isoform B is highly expressed in hypothalamus, but also
Target Synonyms
CD 295; CD295; CD295 antigen; Db; Fa; HuB219; LEP R; LEP-R; LEPR; LEPR_HUMAN; LEPRD; Leptin receptor; Leptin receptor fatty; Leptin receptor gene related protein; Leptin receptor precursor ; Leptin receptor precursor; OB R gene related protein; OB receptor; OB-R; OB-RGRP; obl; Obr
Target Background
The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. It is noteworthy that this gene and LEPROT gene (GeneID:54741) share the same promoter and the first 2 exons, however, encode distinct proteins (PMID:9207021).
Notification