Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LGR5/GPR49 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LGR5/GPR49 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16751A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LGR5/GPR49 |
| Target Synonyms | FEX; HG38; GPR49; GPR67; GRP49; LGR5/GPR49 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse ovary, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL | Uniprot ID | O75473 |
Uniprot Id
O75473
Target Species
Human
Target Name
LGR5
Target Full Name
Leucine-rich repeat-containing G-protein coupled receptor 5
Target Function
Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a stem cell marker of the intestinal epithelium and the hair follicle. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. Involved in the development and/or maintenance of the adult intestinal stem cells during postembryonic development.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in skeletal muscle, placenta, spinal cord, and various region of brain. Expressed at the base of crypts in colonic and small mucosa stem cells. In premalignant cancer expression is not restricted to the cript base. Overexpressed in cancers of th
Target Research Area
Others
Target Synonyms
FEX; G protein coupled receptor 49; G protein coupled receptor 67; g protein-coupled receptor fex; G-protein coupled receptor 49; G-protein coupled receptor 67; G-protein coupled receptor HG38; GPCR GPR49; GPR 49; GPR 67; GPR49; GPR67; GRP 49; GRP49; HG 38; HG38; Leucine rich repeat containing G protein coupled receptor 5 ; Leucine-rich repeat-containing G-protein coupled receptor 5; LGR 5; LGR5; LGR5_HUMAN; MGC117008; Orphan G protein coupled receptor HG38
Target Background
The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
