Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LHFPL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human LHFPL2 (NP_005770.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LHFPL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human LHFPL2 (NP_005770.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03301A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LHFPL2 |
| Target Synonyms | LHFPL2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human LHFPL2 (NP_005770.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQAT | Uniprot ID | Q6ZUX7 |
Uniprot Id
Q6ZUX7
Target Species
Human
Target Name
LHFPL2
Target Full Name
LHFPL tetraspan subfamily member 2 protein
Target Function
Plays a role in female and male fertility. Involved in distal reproductive tract development.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
LHFP family
Target Tissue Specificity
Expressed in all tissues and cell lines examined except brain and peripheral blood leukocytes.
Target Synonyms
LHFPL2; KIAA0206; LHFPL tetraspan subfamily member 2 protein; Lipoma HMGIC fusion partner-like 2 protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
