Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LHX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX3 (Q9UBR4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LHX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX3 (Q9UBR4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14345A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LHX3 |
| Target Synonyms | LIM3; CPHD3; M2-LHX3; LHX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Mouse kidney, Rat brain, 293T, Mouse brain, Mouse uterus, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX3 (Q9UBR4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSG | Uniprot ID | Q9UBR4 |
Uniprot Id
Q9UBR4
Target Species
Human
Target Name
LHX3
Target Full Name
LIM/homeobox protein Lhx3
Target Function
Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with POU1F1/Pit-1. Required for the establishment of the specialized cells of the pituitary gland and the nervous system. Involved in the development of interneurons and motor neurons in cooperation with LDB1 and ISL1.
Target Involvement
Pituitary hormone deficiency, combined, 3 (CPHD3)
Target Subcellular Location
Nucleus.
Target Research Area
Developmental Biology
Target Synonyms
CPHD 3; CPHD3; DKFZp762A2013; LHX 3; LHX3; LHX3_HUMAN; LIM 3; LIM homeobox 3; LIM homeobox gene 3; LIM homeobox protein 3; LIM/homeobox protein Lhx3; LIM/homeodomain protein LHX3; Lim3; M2 LHX3; mLim-3; mLIM3; P LIM
Target Background
This gene encodes a member of a large family of proteins which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene cause combined pituitary hormone deficiency 3. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
