Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LHX6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX6 (NP_001229263.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LHX6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX6 (NP_001229263.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using LHX6 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC):MOLT-4
Exposure time: 30s.
| Cat.No | ADA-08231A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LHX6 |
| Target Synonyms | LHX6; LHX6.1; LIM homeobox 6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX6 (NP_001229263.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGP | Uniprot ID | Q9UPM6 |
Uniprot Id
Q9UPM6
Target Species
Human
Target Name
LHX6
Target Full Name
LIM/homeobox protein Lhx6
Target Function
Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex.
Target Subcellular Location
Nucleus.
Target Synonyms
LHX 6; LHX 6.1; LHX6; LHX6.1; LHX6_HUMAN; LIM homeobox 6; LIM homeobox protein 6; LIM homeodomain protein 6.1; LIM/homeobox protein Lhx6; LIM/homeobox protein Lhx6.1; MGC119542; MGC119544; MGC119545; OTTHUMP00000064113; OTTHUMP00000064114
Target Background
This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein has tandem LIM domains as well as a DNA-binding homeodomain. The protein functions as a transcription factor involved in embryogenesis and head development and is highly expressed in neural crest derived mesenchyme cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
