Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LILRA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-210 of human LILRA1 (NP_006854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LILRA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-210 of human LILRA1 (NP_006854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02174A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LILRA1 |
| Target Synonyms | LIR6; CD85I; LIR-6; LILRA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, B cells, K-562, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 17-210 of human LILRA1 (NP_006854.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSL | Uniprot ID | O75019 |
Uniprot Id
O75019
Target Species
Human
Target Name
LILRA1
Target Full Name
Leukocyte immunoglobulin-like receptor subfamily A member 1
Target Function
May act as receptor for class I MHC antigens.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected in monocytes and B-cells.
Target Synonyms
LILRA1; LIR6; Leukocyte immunoglobulin-like receptor subfamily A member 1; CD85 antigen-like family member I; Leukocyte immunoglobulin-like receptor 6; LIR-6; CD antigen CD85i
Target Background
This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompatibility complex class I ligands, and contributes to the regulation of immune responses. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
