-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LILRB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-460 of human LILRB1 (Q8NHL6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LILRB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-460 of human LILRB1 (Q8NHL6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03266A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LILRB1 |
| Target Synonyms | ILT2; LIR1; MIR7; PIRB; CD85J; ILT-2; LIR-1; MIR-7; PIR-B; LILRB1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-460 of human LILRB1 (Q8NHL6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLG | Uniprot ID | Q8NHL6 |
Uniprot Id
Q8NHL6
Target Species
Human
Target Name
LILRB1
Target Full Name
Leukocyte immunoglobulin-like receptor subfamily B member 1
Target Function
Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles. Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inhibitory signals and down-regulation of the immune response. Engagement of LILRB1 present on natural killer cells or T-cells by class I MHC molecules protects the target cells from lysis. Interaction with HLA-B or HLA-E leads to inhibition of FCER1A signaling and serotonin release. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions. Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide. Upon interaction with peptide-bound HLA-G-B2M complex, triggers secretion of growth-promoting factors by decidual NK cells. Reprograms B cells toward an immune suppressive phenotype.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 5]: Secreted.
Target Tissue Specificity
Expressed in B cells, monocytes and various dendritic cell (DC) subsets including myeloid, plasmacytoid and tolerogenic DCs (at protein level). Expressed in decidual macrophages (at protein level). Expressed in decidual NK cells (at protein level).
Target Synonyms
CD85; CD85 antigen; CD85 antigen like family member J; CD85 antigen-like family member J; CD85j; CD85j antigen; Ig like transcript 2; ILT 2; ILT-2; ILT2; immunoglobulin like transcript 2; Immunoglobulin-like transcript 2; leukocyte Ig like receptor 1; Leukocyte immunoglobulin like receptor 1; leukocyte immunoglobulin like receptor subfamily B member 1; Leukocyte immunoglobulin like receptor subfamily B member 1 precursor; leukocyte immunoglobulin like receptor subfamily B member 1 soluble isoform; leukocyte immunoglobulin like receptor, subfamily B, member 1; Leukocyte immunoglobulin-like receptor 1; Leukocyte immunoglobulin-like receptor subfamily B member 1; leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1; LILRB1; LIR 1; LIR-1; LIR1; LIRB1_HUMAN; MIR 7; MIR-7; MIR7; Monocyte/macrophage immunoglobulin like receptor 7; Monocyte/macrophage immunoglobulin-like receptor 7; PIR B; PIRB
Target Background
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification