-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LILRB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human LILRB3 (NP_001307889.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LILRB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human LILRB3 (NP_001307889.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10005A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LILRB3 |
| Target Synonyms | HL9; ILT5; LIR3; PIRB; CD85A; ILT-5; LIR-3; PIR-B; LILRA6; LILRB3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human LILRB3 (NP_001307889.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGGPEDQPLNPPGSGPQNGLGRYLEVLIGVSVAFVLLLFLLLFLLLLRQRHSKHRTSDQRKTDFQ | Uniprot ID | O75022 |
Uniprot Id
O75022
Target Species
Human
Target Name
LILRB3
Target Full Name
Leukocyte immunoglobulin-like receptor subfamily B member 3
Target Function
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected in monocytes and B-cells.
Target Synonyms
LILRB3; ILT5; LIR3; Leukocyte immunoglobulin-like receptor subfamily B member 3; LIR-3; Leukocyte immunoglobulin-like receptor 3; CD85 antigen-like family member A; Immunoglobulin-like transcript 5; ILT-5; Monocyte inhibitory receptor HL9; CD antigen CD85a
Target Background
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification