-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIN28A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIN28A (Q9H9Z2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LIN28A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIN28A (Q9H9Z2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14419A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIN28A |
| Target Synonyms | CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; LIN28A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIN28A (Q9H9Z2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKS | Uniprot ID | Q9H9Z2 |
Uniprot Id
Q9H9Z2
Target Species
Human
Target Name
LIN28A
Target Full Name
Protein lin-28 homolog A
Target Function
RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism. Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (Probable). 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Suppressor of microRNA (miRNA) biogenesis, including that of let-7, miR107, miR-143 and miR-200c. Specifically binds the miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in pre-miRNA terminal loop, and recruits TUT4 AND tut7 uridylyltransferaseS. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state by preventing let-7-mediated differentiation of embryonic stem cells. Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, such as PFKP, PDHA1 or SDHA, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue.
Target Subcellular Location
Cytoplasm. Rough endoplasmic reticulum. Cytoplasm, P-body. Cytoplasm, Stress granule. Nucleus, nucleolus.
Target Protein Families
Lin-28 family
Target Tissue Specificity
Expressed in embryonic stem cells, placenta and testis. Tends to be up-regulated in HER2-overexpressing breast tumors.
Target Research Area
others
Target Synonyms
AL024421; CSDD1; CSDD2; FLJ12457; Lin 28; Lin 28 homolog (C. elegans); Lin 28 homolog A (C. elegans); Lin 28 homolog A; Lin 28 homolog; Lin-28A; Lin28; Lin28, C. elegans, homolog of, A; LIN28A; LN28A_HUMAN; Protein lin-28 homolog A; Protein lin-28 homolog B; RNA binding protein lin 28; Tex17; ZCCHC1; Zinc finger CCHC domain containing 1; Zinc finger CCHC domain containing protein 1; Zinc finger CCHC domain-containing protein 1
Target Background
This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.
Notification