-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LINGO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-240 of human LINGO1 (NP_116197.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LINGO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-240 of human LINGO1 (NP_116197.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00995A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LINGO1 |
| Target Synonyms | LERN1; MRT64; LRRN6A; UNQ201; LINGO1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, K-562, MCF7, Mouse lung, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-240 of human LINGO1 (NP_116197.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR | Uniprot ID | Q96FE5 |
Uniprot Id
Q96FE5
Target Species
Human
Target Name
LINGO1
Target Full Name
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
Target Function
Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination. Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed exclusively in the central nervous system. Highest level in the in amygdala, hippocampus, thalamus and cerebral cortex. In the rest of the brain a basal expression seems to be always present. Up-regulated in substantia nigra neurons from Parkins
Target Research Area
Developmental Biology
Target Synonyms
FLJ14594; LERN 1; LERN1; Leucine rich repeat and Ig domain containing 1; Leucine rich repeat neuronal 6A; Leucine rich repeat neuronal protein 1; Leucine rich repeat neuronal protein 6A; Leucine-rich repeat and immunoglobilin domain-containing protein 1; Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1; Leucine-rich repeat neuronal protein 1; Leucine-rich repeat neuronal protein 6A; LIGO1_HUMAN; Lingo 1; LINGO1; LRR and Ig domain containing Nogo Receptor interating protein; Lrrn 6a; Lrrn6a; Lrrn6a protein; MGC17422; Nogo Receptor interacting protein; PRO227; UNQ201
Target Background
Predicted to enable epidermal growth factor receptor binding activity. Predicted to act upstream of or within generation of neurons and protein kinase B signaling. Predicted to be located in plasma membrane. Predicted to be active in extracellular matrix and extracellular space. Implicated in autosomal recessive non-syndromic intellectual disability and glaucoma.
Notification