-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIPH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human LIPH (NP_640341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LIPH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human LIPH (NP_640341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05209A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIPH |
| Target Synonyms | AH; LAH2; ARWH2; HYPT7; LPDLR; PLA1B; mPA-PLA1; LIPH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, BxPC-3, DU145, HT-29, Mouse lung, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human LIPH (NP_640341.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ | Uniprot ID | Q8WWY8 |
Uniprot Id
Q8WWY8
Target Species
Human
Target Name
LIPH
Target Full Name
Lipase member H
Target Function
Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG).
Target Involvement
Hypotrichosis 7 (HYPT7); Woolly hair autosomal recessive 2 (ARWH2)
Target Subcellular Location
Secreted. Cell membrane; Peripheral membrane protein.
Target Protein Families
AB hydrolase superfamily, Lipase family
Target Tissue Specificity
Present in intestine (at protein level). Expressed in colon, prostate, kidney, pancreas, ovary, testis, intestine, lung and pancreas. Expressed at lower level in brain, spleen and heart. In hair, it is prominently expressed in hair follicles, including th
Target Synonyms
AH; ARWH2; LAH2; Lipase H; Lipase member H; LIPH; LIPH_HUMAN; LPD lipase related protein; LPD lipase-related protein; LPDLR; Membrane associated phosphatidic acid selective phospholipase A1 alpha; Membrane bound phosphatidic acid selective phospholipase A1; Membrane-associated phosphatidic acid-selective phospholipase A1-alpha; mPA PLA1; mPA-PLA1 alpha; MPAPLA1; OTTHUMP00000210343; OTTHUMP00000210344; Phospholipase A1 member B; PLA1B
Target Background
This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.
Notification