-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lipoprotein lipase (LPL) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Lipoprotein lipase (LPL) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16588A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lipoprotein lipase (LPL) |
| Target Synonyms | LIPD; HDLCQ11; Lipoprotein lipase (LPL) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG | Uniprot ID | P06858 |
Uniprot Id
P06858
Target Species
Human
Target Name
LPL
Target Full Name
Lipoprotein lipase
Target Function
Key enzyme in triglyceride metabolism. Catalyzes the hydrolysis of triglycerides from circulating chylomicrons and very low density lipoproteins (VLDL), and thereby plays an important role in lipid clearance from the blood stream, lipid utilization and storage. Although it has both phospholipase and triglyceride lipase activities it is primarily a triglyceride lipase with low but detectable phospholipase activity. Mediates margination of triglyceride-rich lipoprotein particles in capillaries. Recruited to its site of action on the luminal surface of vascular endothelium by binding to GPIHBP1 and cell surface heparan sulfate proteoglycans.
Target Involvement
Lipoprotein lipase deficiency (LPL deficiency)
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Extracellular side. Secreted. Secreted, extracellular space, extracellular matrix.
Target Protein Families
AB hydrolase superfamily, Lipase family
Target Tissue Specificity
Detected in blood plasma. Detected in milk (at protein level).
Target Synonyms
EC 3.1.1; EC 3.1.1.34; HDLCQ11; LIPD; LIPL_HUMAN; Lipoprotein lipase; LPL; LPL protein; MGC137861
Target Background
LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.
Notification