Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LLGL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human LLGL1 (NP_004131.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against LLGL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human LLGL1 (NP_004131.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07416A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LLGL1 |
| Target Synonyms | DLG4; HUGL; LLGL; Lgl1; Mgl1; HUGL1; HUGL-1; LLGL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse brain, Mouse testis, OVCAR3, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human LLGL1 (NP_004131.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYR | Uniprot ID | Q15334 |
Uniprot Id
Q15334
Target Species
Human
Target Name
LLGL1
Target Full Name
Lethal(2) giant larvae protein homolog 1
Target Function
Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial cells. Involved in axonogenesis through RAB10 activation thereby regulating vesicular membrane trafficking toward the axonal plasma membrane.
Target Subcellular Location
Early endosome membrane. Golgi apparatus, trans-Golgi network membrane. Golgi apparatus membrane. Cell projection, axon. Cytoplasm, cytoskeleton.
Target Protein Families
WD repeat L(2)GL family
Target Tissue Specificity
Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease.
Target Synonyms
DLG4; DLG4, formerly; Hugl 1; HUGL; Hugl-1; HUGL1; Human homolog to the D-lgl gene protein; L2GL1_HUMAN; Lethal giant larvae homolog 1 (Drosophila); Lethal giant larvae homolog 1; Lethal(2) giant larvae protein homolog 1; LLGL; Llgl1; Ly 49G2; Ly49G2; Mgl1; Mlgl
Target Background
This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
