Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LLPH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human LLPH (NP_115714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LLPH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human LLPH (NP_115714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04984A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LLPH |
| Target Synonyms | hLLP; C12orf31; LLPH | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BxPC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human LLPH (NP_115714.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKGLAW | Uniprot ID | Q9BRT6 |
Uniprot Id
Q9BRT6
Target Species
Human
Target Name
LLPH
Target Full Name
Protein LLP homolog
Target Function
In hippocampal neurons, regulates dendritic and spine growth and synaptic transmission.
Target Subcellular Location
Nucleus, nucleolus. Chromosome.
Target Protein Families
Learning-associated protein family
Target Synonyms
C12orf31; Chromosome 12 open reading frame 31; hLLP; Human LAPS18-like protein; LLP homolog, long-term synaptic facilitation (Aplysia); llph; LLPH_HUMAN; MGC104302; MGC14817; Protein LAPS18-like; Protein LLP homolog
Target Background
Enables RNA binding activity. Predicted to be involved in dendrite extension and positive regulation of dendritic spine development. Located in chromosome and nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
