-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMAN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMAN1 (P49257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LMAN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMAN1 (P49257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14173A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMAN1 |
| Target Synonyms | MR60; gp58; F5F8D; FMFD1; MCFD1; ERGIC53; ERGIC-53; LMAN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, Mouse brain, Mouse liver, NCI-H460, Rat kidney, Rat liver, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMAN1 (P49257). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAA | Uniprot ID | P49257 |
Uniprot Id
P49257
Target Species
Human
Target Name
LMAN1
Target Full Name
Protein ERGIC-53
Target Function
Mannose-specific lectin. May recognize sugar residues of glycoproteins, glycolipids, or glycosylphosphatidyl inositol anchors and may be involved in the sorting or recycling of proteins, lipids, or both. The LMAN1-MCFD2 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins.
Target Involvement
Factor V and factor VIII combined deficiency 1 (F5F8D1)
Target Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
LMAN1; ERGIC53; F5F8D; Protein ERGIC-53; ER-Golgi intermediate compartment 53 kDa protein; Gp58; Intracellular mannose-specific lectin MR60; Lectin mannose-binding 1
Target Background
The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency.
Notification