Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMO2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LMO2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09938A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMO2 |
| Target Synonyms | TTG2; LMO-2; RBTN2; RHOM2; RBTNL1; LMO2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-549, LO2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI | Uniprot ID | P25791 |
Uniprot Id
P25791
Target Species
Human
Target Name
LMO2
Target Full Name
Rhombotin-2
Target Function
Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.
Target Involvement
A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.
Target Subcellular Location
Nucleus.
Target Synonyms
Cysteine rich protein TTG 2; Cysteine rich protein TTG2; Cysteine-rich protein TTG-2; LIM domain only 2 (rhombotin like 1); LIM domain only 2; LIM domain only protein 2; LMO 2; LMO-2; lmo2; RBTN 2; RBTN L1; RBTN2; RBTN2_HUMAN; RBTNL 1; RBTNL1; RHOM 2; RHOM2; Rhombotin 2; Rhombotin like 1; Rhombotin-2; Rhombotin2; T cell translocation gene 2; T cell translocation protein 2; T-cell translocation protein 2; TTG 2; TTG2
Target Background
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
