Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LNX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 501-594 of human LNX1 (NP_001119800.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LNX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 501-594 of human LNX1 (NP_001119800.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using LNX1 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-02998A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LNX1 |
| Target Synonyms | LNX; MPDZ; PDZRN2; LNX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, 293F, MCF7, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 501-594 of human LNX1 (NP_001119800.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKE | Uniprot ID | Q8TBB1 |
Uniprot Id
Q8TBB1
Target Species
Human
Target Name
LNX1
Target Full Name
E3 ubiquitin-protein ligase LNX
Target Function
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65.; Isoform 2 provides an endocytic scaffold for IGSF5/JAM4.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expressed in heart, placenta, kidney, pancreas and brain.
Target Synonyms
LNX1; LNX; PDZRN2; UNQ574/PRO1136; E3 ubiquitin-protein ligase LNX; EC 2.3.2.27; Ligand of Numb-protein X 1; Numb-binding protein 1; PDZ domain-containing RING finger protein 2; RING-type E3 ubiquitin transferase LNX
Target Background
This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
