-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LOX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against LOX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-16942A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LOX |
| Target Synonyms | AAT10; LOX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A549, Jurkat, Mouse lung, Rat lung, Rat spleen | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY | Uniprot ID | P28300 |
Uniprot Id
P28300
Target Species
Human
Target Name
LOX
Target Full Name
Protein-lysine 6-oxidase
Target Function
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Target Involvement
Aortic aneurysm, familial thoracic 10 (AAT10)
Target Subcellular Location
Secreted. Secreted, extracellular space.
Target Protein Families
Lysyl oxidase family
Target Tissue Specificity
Heart, placenta, skeletal muscle, kidney, lung and pancreas.
Target Research Area
Cardiovascular, Signal Transduction
Target Synonyms
lox; LYOX; LYOX_HUMAN; Lysyl oxidase; MGC105112; Protein lysine 6 oxidase; Protein-lysine 6-oxidase
Target Background
This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections.
Notification