Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LPCAT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-524 of human LPCAT4 (NP_705841.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LPCAT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-524 of human LPCAT4 (NP_705841.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05722A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LPCAT4 |
| Target Synonyms | AYTL3; AGPAT7; LPEAT2; LPLAT10; LPAAT-eta; LPCAT4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, HT-29, Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 345-524 of human LPCAT4 (NP_705841.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQAEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD | Uniprot ID | Q643R3 |
Uniprot Id
Q643R3
Target Species
Human
Target Name
LPCAT4
Target Full Name
Lysophospholipid acyltransferase LPCAT4
Target Function
Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, lysophosphatidylcholine to phosphatidycholine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl-phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Target Tissue Specificity
Widely expressed with predominant level in brain.
Target Synonyms
LPCAT4; AGPAT7; AYTL3; LPEAT2; Lysophospholipid acyltransferase LPCAT4; 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-alkenylglycerophosphoethanolamine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acyltransferase-like 3; Lysophosphatidylcholine acyltransferase 4; Lysophosphatidylethanolamine acyltransferase 2; Plasmalogen synthase
Target Background
Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are involved in signal transduction (Ye et al., 2005 [PubMed 16243729]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
