-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1621-1720 of human LRP4 (NP_002325.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against LRP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1621-1720 of human LRP4 (NP_002325.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08468A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRP4 |
| Target Synonyms | CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2; LRP4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1621-1720 of human LRP4 (NP_002325.2?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NGGCTHLCFARASDFVCACPDEPDSRPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAPGE | Uniprot ID | O75096 |
Uniprot Id
O75096
Target Species
Human
Target Name
LRP4
Target Full Name
Low-density lipoprotein receptor-related protein 4
Target Function
Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes. May play an essential role in the process of digit differentiation.
Target Involvement
Cenani-Lenz syndactyly syndrome (CLSS); Sclerosteosis 2 (SOST2); Myasthenic syndrome, congenital, 17 (CMS17)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
LDLR family
Target Tissue Specificity
Expressed in bone; present in osteoblasts and osteocytes. No expression is observed in osteoclast. Expressed in several regions of the brain.
Target Research Area
Cardiovascular
Target Synonyms
KIAA0816; LDLR dan; Low density lipoprotein receptor related protein 4; Low-density lipoprotein receptor-related protein 4; LRP-4; LRP10; Lrp4; LRP4_HUMAN; MEGF7; Multiple epidermal growth factor like domains 7 ; Multiple epidermal growth factor-like domains 7
Target Background
This gene encodes a member of the low-density lipoprotein receptor-related protein family. The encoded protein may be a regulator of Wnt signaling. Mutations in this gene are associated with Cenani-Lenz syndrome.
Notification