Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human LRP6 (NP_002327.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human LRP6 (NP_002327.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06816A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRP6 |
| Target Synonyms | ADCAD2; STHAG7; LRP6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LRP6 (NP_002327.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS | Uniprot ID | O75581 |
Uniprot Id
O75581
Target Species
Human
Target Name
LRP6
Target Full Name
Low-density lipoprotein receptor-related protein 6
Target Function
Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. Cell-surface coreceptor of Wnt/beta-catenin signaling, which plays a pivotal role in bone formation. The Wnt-induced Fzd/LRP6 coreceptor complex recruits DVL1 polymers to the plasma membrane which, in turn, recruits the AXIN1/GSK3B-complex to the cell surface promoting the formation of signalsomes and inhibiting AXIN1/GSK3-mediated phosphorylation and destruction of beta-catenin. Required for posterior patterning of the epiblast during gastrulation.
Target Involvement
Coronary artery disease, autosomal dominant, 2 (ADCAD2); Tooth agenesis, selective, 7 (STHAG7)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Membrane raft.
Target Protein Families
LDLR family
Target Tissue Specificity
Widely coexpressed with LRP5 during embryogenesis and in adult tissues.
Target Synonyms
ADCAD2; C030016K15Rik; Cd; FLJ90062; FLJ90421; LDL receptor related protein 6; Low density lipoprotein receptor related protein 6; Low-density lipoprotein receptor-related protein 6; LRP-6; LRP6; LRP6_HUMAN; OTTHUMP00000238979; OTTHUMP00000238980; OTTHUMP00000238982; STHAG7
Target Background
This gene encodes a member of the low density lipoprotein (LDL) receptor gene family. LDL receptors are transmembrane cell surface proteins involved in receptor-mediated endocytosis of lipoprotein and protein ligands. The protein encoded by this gene functions as a receptor or, with Frizzled, a co-receptor for Wnt and thereby transmits the canonical Wnt/beta-catenin signaling cascade. Through its interaction with the Wnt/beta-catenin signaling cascade this gene plays a role in the regulation of cell differentiation, proliferation, and migration and the development of many cancer types. This protein undergoes gamma-secretase dependent RIP- (regulated intramembrane proteolysis) processing but the precise locations of the cleavage sites have not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
