Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRRFIP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-340 of human LRRFIP2 (NP_060194.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LRRFIP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-340 of human LRRFIP2 (NP_060194.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04670A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRRFIP2 |
| Target Synonyms | HUFI-2; LRRFIP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-340 of human LRRFIP2 (NP_060194.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLRY | Uniprot ID | Q9Y608 |
Uniprot Id
Q9Y608
Target Species
Human
Target Name
LRRFIP2
Target Full Name
Leucine-rich repeat flightless-interacting protein 2
Target Function
May function as activator of the canonical Wnt signaling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin. Positively regulates Toll-like receptor (TLR) signaling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding.
Target Protein Families
LRRFIP family
Target Tissue Specificity
Widely expressed, with highest levels in heart and skeletal muscle.
Target Synonyms
5133400F20Rik; AI850587; DKFZp434H2035; FLJ20248; FLJ22683; FLJ58304; HUFI 2; Leucine rich repeat (in FLII) interacting protein 2; Leucine rich repeat flightless interacting protein 2; Leucine-rich repeat flightless-interacting protein 2; LRR FLII interacting protein 2; LRR FLII-interacting protein 2; LRRF2_HUMAN; Lrrfip2
Target Background
The protein encoded by this gene, along with MYD88, binds to the cytosolic tail of toll-like receptor 4 (TLR4), which results in activation of nuclear factor kappa B signaling. The ubiquitin-like protein FAT10 prevents the interaction of the encoded protein and TLR4, thereby inactivating the nuclear factor kappa B signaling pathway. In addition, this protein can downregulate the NLRP3 inflammasome by recruiting the caspase-1 inhibitor Flightless-I to the inflammasome complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
