Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human LRRK1 (NP_078928.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human LRRK1 (NP_078928.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11556A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRRK1 |
| Target Synonyms | OSMD; RIPK6; Roco1; LRRK1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human LRRK1 (NP_078928.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGARDLLEEACDQCASQLEKGQL | Uniprot ID | Q38SD2 |
Uniprot Id
Q38SD2
Target Species
Human
Target Name
LRRK1
Target Full Name
Leucine-rich repeat serine/threonine-protein kinase 1
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, ROCO subfamily
Target Synonyms
KIAA1790; Leucine rich repeat serine/threonine protein kinase 1; Leucine-rich repeat serine/threonine-protein kinase 1; LRRK 1; Lrrk1; LRRK1_HUMAN; RIPK6; Roco1
Target Background
This gene encodes a multi-domain protein that is a leucine-rich repeat kinase and a GDP/GTP binding protein. The encoded protein is thought to play a role in the regulation of bone mass. Mice lacking a similar gene showed severe osteopetrosis, increased bone mineralization and decreased bone resorption.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
