-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human LSM1 (NP_055277.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LSM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human LSM1 (NP_055277.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03213A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSM1 |
| Target Synonyms | CASM; YJL124C; LSM1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human LSM1 (NP_055277.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY | Uniprot ID | O15116 |
Uniprot Id
O15116
Target Species
Human
Target Name
LSM1
Target Full Name
U6 snRNA-associated Sm-like protein LSm1
Target Function
Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation.
Target Subcellular Location
Cytoplasm. Cytoplasm, P-body.
Target Protein Families
SnRNP Sm proteins family
Target Synonyms
Cancer associated Sm like protein; Cancer associated Sm-like; Cancer-associated Sm-like; CASM; lsm1; LSM1; LSM1 homolog; U6 small nuclear RNA associated (S. cerevisiae); Lsm1 protein; LSM1; U6 small nuclear RNA associated; LSM1_HUMAN; Small nuclear ribonuclear CaSm; U6 snRNA associated Sm-like protein LSm1; U6 snRNA-associated Sm-like protein LSm1; YJL124C
Target Background
This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Notification