Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSM10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human LSM10 (NP_116270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LSM10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human LSM10 (NP_116270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00187A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSM10 |
| Target Synonyms | MST074; MSTP074; LSM10 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human LSM10 (NP_116270.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK | Uniprot ID | Q969L4 |
Uniprot Id
Q969L4
Target Species
Human
Target Name
LSM10
Target Full Name
U7 snRNA-associated Sm-like protein LSm10
Target Function
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
Target Subcellular Location
Nucleus.
Target Protein Families
SnRNP Sm proteins family
Target Research Area
Transcription
Target Synonyms
LSM10U7 snRNA-associated Sm-like protein LSm10
Target Background
Enables U7 snRNA binding activity. Involved in positive regulation of G1/S transition of mitotic cell cycle. Located in Cajal body. Part of U7 snRNP.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
