Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LSM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00038A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSM2 |
| Target Synonyms | G7B; snRNP; C6orf28; YBL026W; LSM2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SKOV3, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ | Uniprot ID | Q9Y333 |
Uniprot Id
Q9Y333
Target Species
Human
Target Name
LSM2
Target Full Name
U6 snRNA-associated Sm-like protein LSm2
Target Function
Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
Target Subcellular Location
Nucleus.
Target Protein Families
SnRNP Sm proteins family
Target Synonyms
G7B; snRNP; C6orf28; YBL026W; LSM2
Target Background
This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 19.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
