Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human LSM3 (NP_055278.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LSM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human LSM3 (NP_055278.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03498A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSM3 |
| Target Synonyms | SMX4; USS2; YLR438C; LSM3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human LSM3 (NP_055278.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG | Uniprot ID | P62310 |
Uniprot Id
P62310
Target Species
Human
Target Name
LSM3
Target Full Name
U6 snRNA-associated Sm-like protein LSm3
Target Function
Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
Target Subcellular Location
Nucleus.
Target Protein Families
SnRNP Sm proteins family
Target Synonyms
lsm3; LSM3 homolog; LSM3 protein; LSM3_HUMAN; MDS017; SMX4; U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA associated Sm like protein LSm3; U6 snRNA-associated Sm-like protein LSm3; USS2; YLR438C
Target Background
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
