Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LTB4R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 253-352 of human LTB4R (NP_001137391.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LTB4R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 253-352 of human LTB4R (NP_001137391.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05302A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LTB4R |
| Target Synonyms | BLT1; BLTR; P2Y7; GPR16; LTBR1; P2RY7; CMKRL1; LTB4R1; LTB4R | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 253-352 of human LTB4R (NP_001137391.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN | Uniprot ID | Q15722 |
Uniprot Id
Q15722
Target Species
Human
Target Name
LTB4R
Target Full Name
Leukotriene B4 receptor 1
Target Function
Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.
Target Synonyms
LTB4R; BLT; BLT1; BLTR; CMKRL1; GPR16; P2RY7; Leukotriene B4 receptor 1; LTB4-R 1; LTB4-R1; Chemoattractant receptor-like 1; G-protein coupled receptor 16; P2Y purinoceptor 7; P2Y7
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
