Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LTB4R2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-358 of human LTB4R2 (NP_062813.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LTB4R2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-358 of human LTB4R2 (NP_062813.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10090A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LTB4R2 |
| Target Synonyms | BLT2; NOP9; BLTR2; JULF2; KPG_004; LTB4-R2; LTB4-R 2; LTB4R2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 254-358 of human LTB4R2 (NP_062813.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL | Uniprot ID | Q9NPC1 |
Uniprot Id
Q9NPC1
Target Species
Human
Target Name
LTB4R2
Target Full Name
Leukotriene B4 receptor 2
Target Function
Low-affinity receptor for leukotrienes including leukotriene B4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via G-proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTB4 > 12-epi-LTB4 > LTB5 > LTB3.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
LTB4R2; BLT2R; BLTR2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; LTB4 receptor JULF2; Leukotriene B4 receptor BLT2; Seven transmembrane receptor BLTR2
Target Background
Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within keratinocyte migration and signal transduction. Located in nucleoplasm and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
