-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LXR beta/NER was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human LXR beta/NER (NP_009052.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LXR beta/NER was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human LXR beta/NER (NP_009052.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07913A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LXR beta/NER |
| Target Synonyms | NER; UNR; LXRB; LXR-b; NER-I; RIP15; NR1H2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 3T3-L1, PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human LXR beta/NER (NP_009052.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSR | Uniprot ID | P55055 |
Uniprot Id
P55055
Target Species
Human
Target Name
NR1H2
Target Full Name
Oxysterols receptor LXR-beta
Target Function
Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity. Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8; DLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism. Induces LPCAT3-dependent phospholipid remodeling in endoplasmic reticulum (ER) membranes of hepatocytes, driving SREBF1 processing and lipogenesis. Via LPCAT3, triggers the incorporation of arachidonate into phosphatidylcholines of ER membranes, increasing membrane dynamics and enabling triacylglycerols transfer to nascent very low-density lipoprotein (VLDL) particles. Via LPCAT3 also counteracts lipid-induced ER stress response and inflammation, likely by modulating SRC kinase membrane compartmentalization and limiting the synthesis of lipid inflammatory mediators. Plays an anti-inflammatory role during the hepatic acute phase response by acting as a corepressor: inhibits the hepatic acute phase response by preventing dissociation of the N-Cor corepressor complex.
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR1 subfamily
Target Tissue Specificity
Ubiquitous.
Target Research Area
Cardiovascular
Target Synonyms
Liver X nuclear receptor beta; Liver X receptor beta; LX receptor beta; LXR b; LXR beta; LXRB; NER; NER I; NER1; NR1H 2; NR1H2; NR1H2_HUMAN; Nuclear orphan receptor LXR beta; Nuclear receptor NER; Nuclear receptor subfamily 1 group H member 2; OR-1; Oxysterols receptor LXR-beta; RIP15; Steroid hormone nuclear receptor NER; Ubiquitously-expressed nuclear receptor; UNR
Target Background
The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).
Notification