Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LY6D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-95 of human LY6D (NP_003686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LY6D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-95 of human LY6D (NP_003686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11551A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LY6D |
| Target Synonyms | E48; Ly-6D; LY6D | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-95 of human LY6D (NP_003686.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEK | Uniprot ID | Q14210 |
Uniprot Id
Q14210
Target Species
Human
Target Name
LY6D
Target Full Name
Lymphocyte antigen 6D
Target Function
May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Tissue Specificity
Expressed exclusively at the outer cell surface of transitional epithelia and the keratinocyte of stratified squamous epithelia.
Target Synonyms
LY6D; E48; Lymphocyte antigen 6D; Ly-6D; E48 antigen
Target Background
Predicted to be involved in lymphocyte differentiation. Predicted to act upstream of or within response to stilbenoid. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in cell surface.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
