Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYAR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-160 of human LYAR (NP_060286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LYAR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-160 of human LYAR (NP_060286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13699A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYAR |
| Target Synonyms | ZLYAR; ZC2HC2; AR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-160 of human LYAR (NP_060286.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVAN | Uniprot ID | Q9NX58 |
Uniprot Id
Q9NX58
Target Species
Human
Target Name
LYAR
Target Full Name
Cell growth-regulating nucleolar protein
Target Function
Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs. Also acts at the level of transcription regulation. Along with PRMT5, binds the gamma-globin (HBG1/HBG2) promoter and represses its expression. In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and SNORD41 that encodes a small nucleolar RNA. Preferentially binds to a DNA motif containing 5'-GGTTAT-3'. Negatively regulates the antiviral innate immune response by targeting IRF3 and impairing its DNA-binding activity. In addition, inhibits NF-kappa-B-mediated expression of proinflammatory cytokines. Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells. Prevents nucleolin/NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm. Cell projection, cilium, photoreceptor outer segment.
Target Tissue Specificity
Predominantly expressed in testis.
Target Research Area
Cell Biology
Target Synonyms
Cell growth regulating nucleolar protein; Cell growth-regulating nucleolar protein; Likely ortholog of mouse Ly1 reactive clone ; Ly1 reactive; Ly1 reactive homolog (mouse) ; Ly1 reactive homolog; LYAR; LYAR_HUMAN; ZC2HC2; ZLYAR
Target Background
Enables several functions, including DNA-binding transcription factor binding activity; identical protein binding activity; and transcription regulator inhibitor activity. Involved in several processes, including erythrocyte development; negative regulation of innate immune response; and regulation of transcription, DNA-templated. Located in nucleolus and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
