Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-141 of human LYPD1 (NP_653187.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LYPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-141 of human LYPD1 (NP_653187.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03302A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYPD1 |
| Target Synonyms | PHTS; LYPDC1; LYPD1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-141 of human LYPD1 (NP_653187.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAHC | Uniprot ID | Q8N2G4 |
Uniprot Id
Q8N2G4
Target Species
Human
Target Name
LYPD1
Target Full Name
Ly6/PLAUR domain-containing protein 1
Target Function
Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro increases receptor desensitization and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. May play a role in the intracellular trafficking of alpha-4:beta-2 and alpha-7-containing nAChRs and may inhibit their expression at the cell surface. May be involved in the control of anxiety.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Synonyms
FLJ41033; LY6/PLAUR domain containing 1; Ly6/PLAUR domain-containing protein 1; Lypd1; LYPD1_HUMAN; LYPDC1; MGC29643; PHTS; Putative HeLa tumor suppressor
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
