Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYPLAL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYPLAL1 (NP_620149.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LYPLAL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYPLAL1 (NP_620149.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05214A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYPLAL1 |
| Target Synonyms | Q96AV0; LYPLAL1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYPLAL1 (NP_620149.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQV | Uniprot ID | Q5VWZ2 |
Uniprot Id
Q5VWZ2
Target Species
Human
Target Name
LYPLAL1
Target Full Name
Lysophospholipase-like protein 1
Target Function
Has depalmitoylating activity toward KCNMA1. Does not exhibit phospholipase nor triacylglycerol lipase activity, able to hydrolyze only short chain substrates due to its shallow active site.
Target Subcellular Location
[Isoform 1]: Cytoplasm, cytosol.; [Isoform 2]: Cytoplasm, cytosol.
Target Protein Families
AB hydrolase superfamily, AB hydrolase 2 family
Target Synonyms
BC027340; FLJ99730; KIAA1238; LYPL1_HUMAN; LYPLAL1; Lysophospholipase like 1; Lysophospholipase-like protein 1; MGC28394; OTTHUMP00000035229
Target Background
Predicted to enable carboxylic ester hydrolase activity and palmitoyl-(protein) hydrolase activity. Predicted to be involved in protein depalmitoylation. Predicted to act upstream of or within negative regulation of Golgi to plasma membrane protein transport. Located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
