-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against macroH2A.1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human macroH2A.1 (O75367) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against macroH2A.1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human macroH2A.1 (O75367) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14010A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | macroH2A.1 |
| Target Synonyms | H2A.y; H2A/y; H2AFY; mH2A1; H2AF12M; MACROH2A1.1; macroH2A1.2; macroH2A.1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human macroH2A.1 (O75367). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL | Uniprot ID | O75367 |
Uniprot Id
O75367
Target Species
Human
Target Name
MACROH2A1
Target Full Name
Core histone macro-H2A.1
Target Function
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Involved in stable X chromosome inactivation. Inhibits the binding of transcription factors, including NF-kappa-B, and interferes with the activity of remodeling SWI/SNF complexes. Inhibits histone acetylation by EP300 and recruits class I HDACs, which induces a hypoacetylated state of chromatin.; Binds ADP-ribose and O-acetyl-ADP-ribose, and may be involved in ADP-ribose-mediated chromatin modulation. Increases the expression of genes involved in redox metabolism, including SOD3.; Represses SOD3 gene expression.
Target Subcellular Location
Nucleus. Chromosome.
Target Tissue Specificity
Widely expressed.
Target Synonyms
Core histone macro h2a.1; Core histone macro-H2A.1; H2A histone family member Y ; H2A.y; H2A/y; H2AF12M; H2AFJ; H2afy; H2AY_HUMAN; Histone H2A.Y; Histone macroH2A1; Histone macroH2A1.1; Histone macroH2A1.2; Macroh2a1; MACROH2A1.1; MacroH2A1.2; Medulloblastoma antigen MU MB 50.205 ; Medulloblastoma antigen MU-MB-50.205; mH2a; mH2A1
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification