-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAD2/MAD2L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MAD2/MAD2L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16002A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAD2/MAD2L1 |
| Target Synonyms | MAD2; HSMAD2; MAD2/MAD2L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29, Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS | Uniprot ID | Q13257 |
Uniprot Id
Q13257
Target Species
Human
Target Name
MAD2L1
Target Full Name
Mitotic spindle assembly checkpoint protein MAD2A
Target Function
Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. In the closed conformation (C-MAD2) forms a heterotetrameric complex with MAD1L1 at unattached kinetochores during prometaphase, the complex recruits open conformation molecules of MAD2L1 (O-MAD2) and then promotes the conversion of O-MAD2 to C-MAD2. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore. Cytoplasm. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
MAD2 family
Target Synonyms
HsMAD2; MAD 2; MAD2 like 1; MAD2 mitotic arrest deficient like 1; MAD2-like protein 1; Mad2l1; MD2L1_HUMAN; Mitotic arrest deficient 2-like protein 1; Mitotic spindle assembly checkpoint protein MAD2A; REV7
Target Background
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.
Notification