-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MADCAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MADCAM1 (NP_570116.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MADCAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MADCAM1 (NP_570116.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00494A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MADCAM1 |
| Target Synonyms | MACAM1; MADCAM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Jurkat, Mouse spleen, Rat spleen, SH-SY5Y, SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MADCAM1 (NP_570116.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPP | Uniprot ID | Q13477 |
Uniprot Id
Q13477
Target Species
Human
Target Name
MADCAM1
Target Full Name
Mucosal addressin cell adhesion molecule 1
Target Function
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ov
Target Research Area
Immunology
Target Synonyms
Addressin mucosal; hMAdCAM 1 ; hMAdCAM-1; MACAM1; MADCA_HUMAN; MAdCAM 1; MAdCAM-1; Madcam1; Mucosal addressin cell adhesion molecule 1; Mucosal vascular addressin cell adhesion molecule 1
Target Background
The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined.
Notification