Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAGOHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human MAGOHB (NP_060518.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAGOHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human MAGOHB (NP_060518.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08818A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAGOHB |
| Target Synonyms | MGN2; mago; magoh; MAGOHB | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, PC-12, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human MAGOHB (NP_060518.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI | Uniprot ID | Q96A72 |
Uniprot Id
Q96A72
Target Species
Human
Target Name
MAGOHB
Target Full Name
Protein mago nashi homolog 2
Target Function
Required for pre-mRNA splicing as component of the spliceosome. Plays a redundant role with MAGOH in the exon junction complex and in the nonsense-mediated decay (NMD) pathway.
Target Subcellular Location
Nucleus.
Target Protein Families
Mago nashi family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
FLJ10292; MAGO; Mago nashi homolog 2; Mago nashi homolog B; MAGOH; MAGOH2; MAGOHB; MGN2; MGN2_HUMAN; Protein mago nashi homolog 2
Target Background
Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and nuclear-transcribed mRNA catabolic process, nonsense-mediated decay. Located in nucleus. Part of U2-type catalytic step 1 spliceosome; U2-type precatalytic spliceosome; and exon-exon junction complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
