Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAN1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MAN1A2 (NP_006690.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MAN1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MAN1A2 (NP_006690.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05759A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAN1A2 |
| Target Synonyms | MAN1B; MAN1A2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, LO2, Mouse brain, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MAN1A2 (NP_006690.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALEEAKEKLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK | Uniprot ID | O60476 |
Uniprot Id
O60476
Target Species
Human
Target Name
MAN1A2
Target Full Name
Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
Target Function
Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyl hydrolase 47 family
Target Tissue Specificity
Highest levels of expression in placenta and testis.
Target Research Area
Metabolism
Target Synonyms
MAN1A2; MAN1B; Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB; Mannosidase alpha class 1A member 2; Processing alpha-1,2-mannosidase IB; Alpha-1,2-mannosidase IB
Target Background
Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
