-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAP2K4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MAP2K4 (NP_003001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MAP2K4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MAP2K4 (NP_003001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07781A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAP2K4 |
| Target Synonyms | JNKK; MEK4; MKK4; SEK1; SKK1; JNKK1; SERK1; MAPKK4; PRKMK4; SAPKK1; SAPKK-1; MAP2K4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF-7, Mouse thymus, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MAP2K4 (NP_003001.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD | Uniprot ID | P45985 |
Uniprot Id
P45985
Target Species
Human
Target Name
MAP2K4
Target Full Name
Dual specificity mitogen-activated protein kinase kinase 4
Target Function
Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The phosphorylation of the Thr residue by MAP2K7/MKK7 seems to be the prerequisite for JNK activation at least in response to proinflammatory cytokines, while other stimuli activate both MAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylate JNKs. MAP2K4 is required for maintaining peripheral lymphoid homeostasis. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7 exclusively activates JNKs, MAP2K4/MKK4 additionally activates the p38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
Target Tissue Specificity
Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.
Target Research Area
Signal Transduction
Target Synonyms
c Jun N terminal kinase kinase 1; C-JUN N-terminal kinase kinase 1; Dual specificity mitogen activated protein kinase kinase 4; Dual specificity mitogen-activated protein kinase kinase 4; JNK Activated Kinase 1; JNK activating kinase 1; JNK-activating kinase 1; JNKK; JNKK1; MAP kinase kinase 4; Map2k4; MAPK ERK kinase 4; MAPK/ERK kinase 4; MAPKK 4; MAPKK4; MEK 4; MEK4; Mitogen activated protein kinase kinase 4; MKK 4; MKK4; MP2K4_HUMAN; PRKMK4; SAPK ERK kinase 1; SAPK/ERK kinase 1; SAPKK 1; SAPKK1; SEK1; SERK1; SKK1; Stress activated protein kinase kinase 1
Target Background
This gene encodes a member of the mitogen-activated protein kinase (MAPK) family. Members of this family act as an integration point for multiple biochemical signals and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. They form a three-tiered signaling module composed of MAPKKKs, MAPKKs, and MAPKs. This protein is phosphorylated at serine and threonine residues by MAPKKKs and subsequently phosphorylates downstream MAPK targets at threonine and tyrosine residues. A similar protein in mouse has been reported to play a role in liver organogenesis. A pseudogene of this gene is located on the long arm of chromosome X. Alternative splicing results in multiple transcript variants.
Notification