Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAP3K1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MAP3K1 (NP_005912.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MAP3K1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MAP3K1 (NP_005912.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of various lysates using MAP3K1 at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-07769A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAP3K1 |
| Target Synonyms | MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1; MAP3K1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Raji | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MAP3K1 (NP_005912.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW | Uniprot ID | Q13233 |
Uniprot Id
Q13233
Target Species
Human
Target Name
MAP3K1
Target Full Name
Mitogen-activated protein kinase kinase kinase 1
Target Function
Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. May phosphorylate the MAPK8/JNK1 kinase. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.
Target Involvement
46,XY sex reversal 6 (SRXY6)
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Target Synonyms
M3K1_HUMAN; MAP3K1; MAPK/ERK kinase kinase 1; MAPKKK1; MEK kinase 1; MEKK 1; Mekk; MEKK1; Mitogen activated protein kinase kinase kinase 1; Mitogen activated protein kinase kinase kinase 1; E3 ubiquitin protein ligase; Mitogen-activated protein kinase kinase kinase 1; SRXY6
Target Background
The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
