-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAPK13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPK13 (O15264) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAPK13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPK13 (O15264) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04160A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAPK13 |
| Target Synonyms | SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta; MAPK13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, 5637, Mouse lung, Mouse pancreas, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPK13 (O15264). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL | Uniprot ID | O15264 |
Uniprot Id
O15264
Target Species
Human
Target Name
MAPK13
Target Full Name
Mitogen-activated protein kinase 13
Target Function
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Target Tissue Specificity
Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells.
Target Research Area
Cell Biology
Target Synonyms
MAP kinase 13; MAP kinase p38 delta; MAPK 13; MAPK-13; Mapk13; MGC99536; Mitogen activated protein kinase 13; Mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; MK13_HUMAN; OTTHUMP00000016282; OTTHUMP00000016283; p38 delta; P38delta; PRKM13; SAPK 4 ; SAPK4; Stress activated protein kinase 4; Stress-activated protein kinase 4
Target Background
This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene.
Notification